Campus Alert Archive
Penn

Penn Stays Silent While Citizen App Lights Up: False Gunman Reports at Harrison College House Test the Limits of UPennAlert

PAswattingadvisorymedium confidence
UnfoundedNo evidence of an actual threat was found. The institutional response is documented because the alert communication is identical to what would occur during a real incident.

On Saturday afternoon, January 31, 2026, false reports of a gunman near Harrison College House circulated rapidly among Penn students after notifications from the Citizen crime-reporting app alleged shots fired on the west side of campus. Philadelphia Police were notified at 1:54 PM EST but found no evidence. The University of Pennsylvania never sent a UPennAlert message — leaving students confused and afraid about whether the threat was real or imagined.

Alerts
2
Response
—
Killed
0
Injured
0
Institution
University of Pennsylvania
Private R1 · PA
~28,200 studentsUPennAlert
Confirmed Timeline

Alert Sequence

2 messages in sequence

Some alert texts below are approximate reconstructions from news coverage, not confirmed verbatim transcripts. Reconstructed texts are shown in italic with a dashed border. Verified verbatim texts have a solid border and are marked accordingly.

INITIAL ALERTPush
Approximate reconstruction89 chars
Citizen Alert: Reports of shots fired in the area of Harrison College House. Use caution.

This text has been reconstructed from news coverage and may not reflect the exact original wording.

The notification originated from the third-party Citizen app — not UPenn's official UPennAlert Emergency Notification System
Philadelphia Police Department scanner audio reviewed by The Daily Pennsylvanian showed police were notified at 1:54 PM EST
Citizen app notifications are based on user reports and police scanner monitoring, not verified emergencies — but Penn students reported they had no other information to evaluate the threat
The Daily Pennsylvanian later wrote that 'rumors about false reports of a gunman near Harrison College House circulated among the student body' for hours without any official UPenn confirmation or denial
FOLLOW-UPWebsite
Approximate reconstruction254 chars
The University of Pennsylvania Division of Public Safety did not issue a UPennAlert in response to reports circulating on social media and the Citizen app of a gunman near Harrison College House. PPD investigated and confirmed no threat to the community.

This text has been reconstructed from news coverage and may not reflect the exact original wording.

Penn's Division of Public Safety relies on UPennAlert to 'quickly notify the Penn and surrounding Philadelphia community of critical information during significant emergencies or dangerous situations' — but on January 31, the system stayed silent
Students told The Daily Pennsylvanian they 'never received anything official from the University saying that there was or wasn't a threat'
The incident raised questions about Penn's threshold for issuing UPennAlerts versus relying on third-party apps to fill the information void
Context

Background

On Saturday afternoon, January 31, 2026, false reports of a gunman near Harrison College House — one of Penn's high-rise residences on the west side of campus — spread rapidly among students through the Citizen crime-reporting app and social media. According to Philadelphia Police Department scanner audio reviewed by The Daily Pennsylvanian, police were notified at 1:54 PM EST. Officers responded but found no evidence of any shooting. Penn's Division of Public Safety operates the UPennAlert Emergency Notification System, which is designed to 'quickly notify the Penn and surrounding Philadelphia community of critical information during significant emergencies or dangerous situations.' But on January 31, the system stayed silent, even as students described feeling confused and afraid. The DP later editorialized that 'when rumors spread faster than UPennAlert, students lose trust' — a critique that mirrored similar criticisms of USF's AlertUSF system after a 2025 swatting hoax. The incident at Penn typified a problem peculiar to the era of crowdsourced crime apps: when official channels remain silent during a fast-moving rumor, third-party platforms fill the void with unverified information that students then treat as authoritative. The Penn incident occurred during a January 2026 wave of campus hoax threats and shootings (including a real shooting at Brown) that had heightened student anxiety nationwide.
Analysis

Key Findings

The Penn incident illustrates a new failure mode in campus emergency communication: when the institutional system stays silent, third-party crime apps like Citizen become the de facto information channel — without verification
Penn's decision not to issue a UPennAlert was likely defensible (no verified threat existed) but communicatively damaging — students felt abandoned during a perceived emergency
The Daily Pennsylvanian editorial response argued that brief 'no threat detected' notifications from the University would have been preferable to silence
The incident occurred during a January 2026 cluster of campus shooting concerns following a real shooting at Brown University, raising baseline anxiety levels
Outcome
No injuries and no evidence of any shooting. PPD investigated and found no threat. Penn's Division of Public Safety did not issue a UPennAlert, drawing significant criticism from students and the Daily Pennsylvanian editorial board for the communications gap.
Provenance

Sources

  1. Student Paper
    Penn students 'confused' by false reports of man with gun on campus, lack of University notification (Daily Pennsylvanian)
    thedp.com
  2. News
    After Brown shooting, Northeast, Central Pa. college campuses evaluate safety, security (WVIA)
    wvia.org
  3. Source
    Citizen crime-reporting app
    citizen.com
Tags
swattingfalse-alarmpennsylvaniaphiladelphiapennprivate-r1ivy-leaguecommunication-failurecitizen-appharrison-college-houseUnfounded
Added May 2026Updated May 2026Via ingestion