Skip to content
Campus Alert Archive
Pitt

A 'He Said He Had a Gun' ATM Robbery on Oakland Avenue

PArobberytimely warningmedium confidence

Around 9:30 p.m. on Thursday, September 28, 2023, two University of Pittsburgh students were robbed on the 300 block of Oakland Avenue near campus when a man claimed he had a gun, forced them to discard their phones, and made them withdraw money from an ATM. Pitt campus police posted a Crime Alert to their X account at 1:50 a.m. Friday; CBS Pittsburgh reported the victims never actually saw a weapon.

Alerts
1
Response
Killed
Injured
Institution
University of Pittsburgh
Public R1 · PA
Pitt Crime Alert
Confirmed Timeline

Alert Sequence

1 message in sequence

Some alert texts below are approximate reconstructions from news coverage, not confirmed verbatim transcripts. Reconstructed texts are shown in italic with a dashed border. Verified verbatim texts have a solid border and are marked accordingly.

INITIAL ALERTTwitter/X
Pitt Police Crime Alert: A robbery was reported on the 300 block of Oakland Ave. A male suspect implied he had a gun, took two victims' phones and forced them to withdraw money from an ATM before fleeing south on Oakland Ave. Suspect: Black male, 30s-40s, eyeglasses, black beanie, beige trench coat, dark pants. Anyone with information, call Pitt Police at 412-624-2121.

This text has been reconstructed from news coverage and may not reflect the exact original wording.

The roughly four-hour gap between the 9:30 p.m. robbery and the 1:50 a.m. crime alert drew student criticism that Pitt's alerts arrive too late, a recurring complaint about the Oakland neighborhood's timely warnings.
The 300 block of Oakland Avenue is a student-dense stretch of the Oakland business district immediately adjacent to Pitt's campus, well within the university's Clery geography.
Context

Background

The University of Pittsburgh's campus sits inside the dense Oakland neighborhood, and the Pitt Office of Public Safety issues Crime Alerts for serious or continuing threats in its Clery geography. This September 28, 2023 ATM robbery of two students on Oakland Avenue, reported by CBS Pittsburgh, was one of several 2023 Oakland robberies, and the late-night timing of the crime alert fed student concerns that warnings can arrive hours after an incident happens. Pitt's crime alerts include the nature, date, time, and general location of the crime; suspect descriptions are included at the discretion of the Chief of Police, which is why this alert carried a detailed description that aided the eventual arrest.
Outcome
The victims were not physically harmed. Eric Ingram, 53, was later charged with robbery, false imprisonment, and unlawful restraint and taken into custody.
Provenance

Sources

  1. News
  2. News
  3. Official
Tags
robberytimely-warningpennsylvaniapittsburghoaklandatm-robberyoff-campus
Added May 2026Updated May 2026Via ingestion